PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G148500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family B3
Protein Properties Length: 1009aa    MW: 113338 Da    PI: 9.3616
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G148500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B332.31.8e-103534221689
                         EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                  B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                         + lp   a + +    +++ + l+d++g+s +++l  +   g+  + +GW+eF +++ ++ gDf+vF+++g s 
  Brast04G148500.1.p 353 MLLPPMIAPKLKDL--TNRRVYLKDSEGKSSKIRL--SVVEGSLAFYQGWNEFISDHSINWGDFLVFEYIGMSA 422
                         44555555444333..4557***************..7778889999**********************98555 PP

2B333.76.3e-119399952987
                         -..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                  B3  29 kkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                         + +++  ++l+d+  r W v +    +s  + +t+GW++ v an+L++gD++++  d +
  Brast04G148500.1.p 939 SRQNQSVIMLKDPMKRLWPVFY--HENSLFVGFTRGWESIVAANNLQTGDVCTLLKDLD 995
                         33344589**************..9****************************985433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.14E-15336439IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.4E-14337437IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.335338437IPR003340B3 DNA binding domain
CDDcd100172.11E-9339434No hitNo description
SMARTSM010190.0045341437IPR003340B3 DNA binding domain
PfamPF023621.9E-8352422IPR003340B3 DNA binding domain
PROSITE profilePS508639.6579101008IPR003340B3 DNA binding domain
SMARTSM010190.00119151006IPR003340B3 DNA binding domain
SuperFamilySSF1019361.82E-119171000IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.1E-109171004IPR015300DNA-binding pseudobarrel domain
PfamPF023621.3E-89231003IPR003340B3 DNA binding domain
CDDcd100175.73E-99451007No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1009 aa     Download sequence    Send to blast
MSGGVPELAC RKRLRSCDVN VKKKEEGRKK MHSDEDEEEG MEMRGGGKKV KSMKASTAKS  60
EKEKRREMPT NLSDEEEMET WDTDETVKNK EEKRMHSGHG KATDRKASMA TFEKVKKKKL  120
VSSDGGEMKM QSGDHERDKR KNIPFPFNKN KDPSKENNRK MPSRNCSEKK MGSGDHHKDK  180
MRNRAQPLDK SKHSEKEKVK ILSSHNGEKK NMWSHDHDKD KRGSTPLQWS KSEKKTCDAK  240
EKKTWPCACM EMKMHNCDSN EKKKKNASLV LSKENKIQTM TNNKRKNMNL TVSSKEKKMR  300
TDDKGNSGES DGRWKKMKMQ GYNKVPKVQS GDTEKRNLPA FFKFICNNFE EFMLLPPMIA  360
PKLKDLTNRR VYLKDSEGKS SKIRLSVVEG SLAFYQGWNE FISDHSINWG DFLVFEYIGM  420
SAFSGRSTFS VRIFGIDSCE RLSFNVERPC GKKEQKESHA HDDLVPSHRF RNLEDMNGHR  480
YDSGEYLGSK GTKSKPSGCM NNHDIASCSL GSKSMNAASG TCHMAANSKE DLSRVASGFK  540
CGHLVALDNK NGYLANGENK AKNIYPICRK GKSRNEVIEI TDEPPVAQET EDAAKLTTLD  600
TVSQMHDVTA ATKQDPKGVV CGRCGSPVAL DNEERNVAIG EGKTKCTSST CNNEKIRRNE  660
IISVNDAAPL AQEKADGVQL KSIYRHIEDS SMMKESEMKV ASATKCPEMH DSDEGLRRKQ  720
EGNALKLKCT TILDNPNDGK MNVIGNVCNN YEAPGGSQCS EKSKKAIVSG QGYLDSSGLI  780
RSEKLLKTGG KPVDNCSAIR LNPAHESYLQ PMAGKISKSG HIMREIYHPV NAIGTTFQLQ  840
TEKEQPEPDI NIVSRQRNNI PVRANHVVAC QSEHNFLRQG EMKSSSHVTP VPLLPVKSEV  900
LESDDRSGLK TGMQFCIPST SQTWLELPCS LSNAVWQKSR QNQSVIMLKD PMKRLWPVFY  960
HENSLFVGFT RGWESIVAAN NLQTGDVCTL LKDLDEVEHV YHVEITRK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575292.20.0PREDICTED: B3 domain-containing protein Os02g0598200-like isoform X1
RefseqXP_014755477.10.0PREDICTED: B3 domain-containing protein Os02g0598200-like isoform X1
TrEMBLI1IB860.0I1IB86_BRADI; Uncharacterized protein
STRINGBRADI3G47847.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122722730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34400.11e-10B3 family protein